}, LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "linkDisabled" : "false" "context" : "envParam:quiltName", "useTruncatedSubject" : "true", ], { "actions" : [ { { }, }, { } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "forceSearchRequestParameterForBlurbBuilder" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Bist du sicher, dass du fortfahren möchtest? "event" : "markAsSpamWithoutRedirect", o.innerHTML = "Page number can\'t exceed 2. } ] "context" : "", ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "MessagesWidgetAnswerForm", } }, } "}); LITHIUM.Loader.runJsAttached(); "context" : "envParam:quiltName", { "action" : "rerender" } })(LITHIUM.jQuery); LITHIUM.AjaxSupport.ComponentEvents.set({ }; ], ] { { { return false; } ] { }, } "useCountToKudo" : "false", "action" : "addClassName" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ "action" : "rerender" ], ] o.innerHTML = "Page must be in a numeric format. LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); }, }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", }, } "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_32","feedbackSelector":".InfoMessage"}); }, LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName,message", "actions" : [ "actions" : [ { "eventActions" : [ $(document).ready(function(){ "action" : "rerender" ;(function($) { { { } "action" : "rerender" } "event" : "AcceptSolutionAction", "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_69bbf8151d1367', 'disableAutoComplete', '#ajaxfeedback_69bbf8147b1a9f_0', 'LITHIUM:ajaxError', {}, 'XJ7YGDffWVNWNkU5snWSJZfyn86EDLahJw6-dei_i3Y. ] }, "event" : "MessagesWidgetEditAnswerForm", } "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "expandMessage", { { "actions" : [ { "closeEvent" : "LITHIUM:lightboxCloseEvent", "context" : "", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "kudosable" : "true", "actions" : [ { ] "initiatorDataMatcher" : "data-lia-message-uid" }, ] "event" : "deleteMessage", }, }, "event" : "MessagesWidgetCommentForm", { "event" : "ProductAnswerComment", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2121344,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", o.innerHTML = ""; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "includeRepliesModerationState" : "false", ] "action" : "rerender" } ] lithadmin: [] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "removeThreadUserEmailSubscription", { "context" : "", "action" : "rerender" "truncateBody" : "true", "action" : "pulsate" "event" : "RevokeSolutionAction", "action" : "pulsate" }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:quiltName", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" "action" : "rerender" "event" : "AcceptSolutionAction", "parameters" : { "action" : "rerender" } "action" : "rerender" { } } { } { { LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" ] ] "kudosLinksDisabled" : "false", //resetMenu(); "context" : "", "context" : "envParam:quiltName", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StoerungsmeldungenMobilfunkLTE/thread-id/73389","ajaxErrorEventName":"LITHIUM:ajaxError","token":"xg0U9nOo0jYYfx2cICB3ESbTtG7mMPYzslIpzP45i6I. "action" : "rerender" "disableLabelLinks" : "false", } "action" : "rerender" "actions" : [ "context" : "envParam:quiltName", setWarning(pagerId); ] "dialogKey" : "dialogKey" "event" : "addThreadUserEmailSubscription", { { "event" : "editProductMessage", { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "context" : "", { } ] } "event" : "MessagesWidgetAnswerForm", "action" : "rerender" ] LITHIUM.Dialog.options['1848795657'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "useSubjectIcons" : "true", "action" : "pulsate" }, LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message,product,contextId,contextUrl", return false; { { "context" : "", "displaySubject" : "true", }); Bist du sicher, dass du fortfahren möchtest? "actions" : [ { "context" : "lia-deleted-state", "revokeMode" : "true", "event" : "MessagesWidgetEditAnswerForm", { "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "action" : "rerender" { { { "componentId" : "kudos.widget.button", "triggerEvent" : "click", ] "parameters" : { "truncateBodyRetainsHtml" : "false", { "action" : "rerender" { "actions" : [ "context" : "envParam:feedbackData", "context" : "", "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); } "action" : "rerender" ] "displaySubject" : "true", "context" : "envParam:quiltName,expandedQuiltName", "event" : "addThreadUserEmailSubscription", return; "context" : "envParam:quiltName", "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", ], // Reset the conditions so that someone can do it all again. }); ;(function($) { "context" : "", "quiltName" : "ForumMessage", "context" : "", "event" : "expandMessage", } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_721cef3d2cbea9', 'disableAutoComplete', '#ajaxfeedback_721cef3c378eed_0', 'LITHIUM:ajaxError', {}, 'Th1Kdof_DHUb5cv-3-HlhhIot-bIKfRf_Ceaj-7rOBI. "event" : "removeMessageUserEmailSubscription", "context" : "envParam:entity", "event" : "editProductMessage", "selector" : "#messageview_1", }, "actions" : [ "context" : "", "event" : "expandMessage", ] } ] { }, "initiatorDataMatcher" : "data-lia-message-uid" } })(LITHIUM.jQuery); "kudosable" : "true", "event" : "MessagesWidgetEditAction", "actions" : [ ] }, if (isNaN(val) ) }, } "disableLabelLinks" : "false", ] { }, { "eventActions" : [ "parameters" : { { setWarning(pagerId); "action" : "rerender" { ] }, "initiatorBinding" : true, } "useSubjectIcons" : "true", { LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); } })(LITHIUM.jQuery); { }, "action" : "pulsate" ] $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditCommentForm", ;(function($) { { { C. Chrisxfire Neues Mitglied. }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "showCountOnly" : "false", { "context" : "envParam:selectedMessage", "useSimpleView" : "false", { }, { "initiatorDataMatcher" : "data-lia-kudos-id" { ] } "event" : "removeMessageUserEmailSubscription", }, // We made it! ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.Dialog.options['-248679667'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivStoerungsmeldungenMobilfunkLTE/thread-id/63936","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ES0WP4Wc0bEWpsE--ePgqY2PHMJcVla8l0hFvVa2LMg. "parameters" : { }); } "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1822090 .lia-rating-control-passive', '#form_8'); { event.returnValue = false; var do_scroll = sessionStorage.is_scroll; "context" : "", } LITHIUM.AjaxSupport.ComponentEvents.set({ "linkDisabled" : "false" { "event" : "MessagesWidgetEditAnswerForm", "componentId" : "kudos.widget.button", } { } ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "unapproveMessage", ] "event" : "MessagesWidgetEditAction", // Set start to true only if the first key in the sequence is pressed "actions" : [ ] } "initiatorDataMatcher" : "data-lia-kudos-id" ] } "action" : "rerender" "action" : "rerender" "event" : "deleteMessage", "selector" : "#kudosButtonV2_5", ;(function($) { { "action" : "rerender" { } "actions" : [ "event" : "markAsSpamWithoutRedirect", "parameters" : { }, LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "eventActions" : [ "linkDisabled" : "false" }, }, "}); "event" : "deleteMessage", "message" : "1822064", } "context" : "", "event" : "MessagesWidgetMessageEdit", ] "}); } "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" { window.scrollTo(0,position_x.top - 150); "context" : "", ], }, "actions" : [ ], "event" : "MessagesWidgetEditAnswerForm", { @AirbusA350 Prüfe mal deine genaue Adresse in der Vodafone Netzabdeckungskarte. "action" : "rerender" }, { "event" : "expandMessage", function doChecks(pagerId, val) { "context" : "envParam:feedbackData", "actions" : [ "context" : "", ] }, }, "; } $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ // We made it! "dialogKey" : "dialogKey" } }, LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); }, } "useSimpleView" : "false", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "quiltName" : "ForumMessage", "kudosLinksDisabled" : "false", { LITHIUM.Dialog.options['2105161911'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ }, } "event" : "removeMessageUserEmailSubscription", "actions" : [ { "linkDisabled" : "false" LITHIUM.AjaxSupport.ComponentEvents.set({ } var key = e.keyCode; "includeRepliesModerationState" : "false", "action" : "rerender" "context" : "envParam:quiltName", LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'cBUdVxbQLyrFeB7nWO1HTIz2LxL4gU1--eLz-JVG85c. }, "disableLabelLinks" : "false", }, ] }, } $('#vodafone-community-header').toggle(); } { } // console.log('watching: ' + key); "includeRepliesModerationState" : "false", "truncateBodyRetainsHtml" : "false", "showCountOnly" : "false", ] "context" : "lia-deleted-state", "event" : "addThreadUserEmailSubscription", }, }, "actions" : [ "event" : "kudoEntity", ], } LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'yf2vJyAwvjHeW4dUFTDUKrN9JcYMI_Kl96p6NUDoARY. { ] "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "kudosLinksDisabled" : "false", "event" : "RevokeSolutionAction", { }, ', 'ajax'); }, { } .attr('aria-hidden','true') "event" : "expandMessage", }, "event" : "editProductMessage", "event" : "RevokeSolutionAction", "componentId" : "forums.widget.message-view", "actions" : [ "event" : "editProductMessage", "actions" : [ { "context" : "", { { "actions" : [ "componentId" : "kudos.widget.button", LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "displayStyle" : "horizontal", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1821662 .lia-rating-control-passive', '#form_2'); }, "event" : "kudoEntity", "action" : "rerender" { { "event" : "ProductMessageEdit", })(LITHIUM.jQuery); "action" : "rerender" ] "action" : "rerender" "event" : "MessagesWidgetAnswerForm", ] "action" : "rerender" "event" : "AcceptSolutionAction", "event" : "approveMessage", "action" : "rerender" "event" : "MessagesWidgetEditAction", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ], "action" : "rerender" ] "eventActions" : [ "action" : "rerender" LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { $(this).toggleClass("view-btn-open view-btn-close"); "event" : "RevokeSolutionAction", }, "action" : "rerender" "context" : "", "kudosable" : "true", "action" : "rerender" "action" : "rerender" ], { { "actions" : [ "actions" : [ }, "activecastFullscreen" : false, } { "actions" : [ }, LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { }, { "event" : "markAsSpamWithoutRedirect", } "action" : "rerender" } } }, "context" : "envParam:quiltName", Für Probleme mit mobilem Internet bietet 1&1 deutlich mehr Hilfestellung. { "eventActions" : [ if (isNaN(val) ) ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ } "event" : "editProductMessage", "context" : "", ] }, { ] } "event" : "MessagesWidgetMessageEdit", ] if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { "event" : "MessagesWidgetEditCommentForm", "actions" : [ { "context" : "lia-deleted-state", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", }, ] "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "quiltName" : "ForumMessage", "event" : "ProductAnswerComment", { "action" : "rerender" "action" : "rerender" else { ] "actions" : [ BItte um Klärung! if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { o.innerHTML = "Page number must be 1 or greater.